![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [188309] (2 PDB entries) |
![]() | Domain d3boma_: 3bom A: [172731] automated match to d1outa_ complexed with edo, hem |
PDB Entry: 3bom (more details), 1.35 Å
SCOPe Domain Sequences for d3boma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3boma_ a.1.1.2 (A:) automated matches {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]} slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp eihlsvdkflqqlalalaekyr
Timeline for d3boma_: