| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.4: Laminin G-like module [49944] (7 proteins) |
| Protein automated matches [190380] (3 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries) |
| Domain d3boda1: 3bod A:86-258 [172730] Other proteins in same PDB: d3boda2 automated match to d1c4ra_ complexed with ca |
PDB Entry: 3bod (more details), 1.7 Å
SCOPe Domain Sequences for d3boda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3boda1 b.29.1.4 (A:86-258) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylelhihq
gkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypagrqlt
ifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv
Timeline for d3boda1: