Lineage for d3boda1 (3bod A:86-258)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779532Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2779614Protein automated matches [190380] (3 species)
    not a true protein
  7. 2779620Species Mouse (Mus musculus) [TaxId:10090] [188387] (10 PDB entries)
  8. 2779625Domain d3boda1: 3bod A:86-258 [172730]
    Other proteins in same PDB: d3boda2
    automated match to d1c4ra_
    complexed with ca

Details for d3boda1

PDB Entry: 3bod (more details), 1.7 Å

PDB Description: structure of mouse beta-neurexin 1
PDB Compounds: (A:) Neurexin-1-alpha

SCOPe Domain Sequences for d3boda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3boda1 b.29.1.4 (A:86-258) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylelhihq
gkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypagrqlt
ifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

SCOPe Domain Coordinates for d3boda1:

Click to download the PDB-style file with coordinates for d3boda1.
(The format of our PDB-style files is described here.)

Timeline for d3boda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3boda2