Lineage for d3bnxd_ (3bnx D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010800Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 protein domains)
  6. 2010815Protein automated matches [190618] (1 species)
    not a true protein
  7. 2010816Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2010848Domain d3bnxd_: 3bnx D: [172723]
    automated match to d1dgpa_
    complexed with bme, fpp, gol, mg, pop

Details for d3bnxd_

PDB Entry: 3bnx (more details), 2.1 Å

PDB Description: Crystal structure of Aristolochene synthase complexed with farnesyl diphosphate
PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d3bnxd_:

Sequence, based on SEQRES records: (download)

>d3bnxd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
glklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqea
dvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqtt
lrysv

Sequence, based on observed residues (ATOM records): (download)

>d3bnxd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
slepppstfqplchplveevskevdgyflqhwnnekarkkfvaagfsrvtclyfpkaldd
rihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwes
mrahdremadeilepvflfmraqtdrarpmglggyleyrerdvgkellaalmrfsmglkl
spselqrvreidancskhlsvvndiysyekelylctsvqilaqeadvtaeaakrvlfvmc
rewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv

SCOPe Domain Coordinates for d3bnxd_:

Click to download the PDB-style file with coordinates for d3bnxd_.
(The format of our PDB-style files is described here.)

Timeline for d3bnxd_: