SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3bnxd_ (3bnx D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010800Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 protein domains)
  6. 2010815Protein automated matches [190618] (1 species)
    not a true protein
  7. 2010816Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2010848Domain d3bnxd_: 3bnx D: [172723]
    automated match to d1dgpa_
    complexed with bme, fpp, gol, mg, pop

Details for d3bnxd_

PDB Entry: 3bnx (more details), 2.1 Å

PDB Description: Crystal structure of Aristolochene synthase complexed with farnesyl diphosphate
PDB Compounds: (D:) Aristolochene synthase

SCOPe Domain Sequences for d3bnxd_:

Sequence, based on SEQRES records: (download)

>d3bnxd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
slepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkal
ddrihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlw
esmrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsm
glklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqea
dvtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqtt
lrysv

Sequence, based on observed residues (ATOM records): (download)

>d3bnxd_ a.128.1.4 (D:) automated matches {Aspergillus terreus [TaxId: 33178]}
slepppstfqplchplveevskevdgyflqhwnnekarkkfvaagfsrvtclyfpkaldd
rihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwes
mrahdremadeilepvflfmraqtdrarpmglggyleyrerdvgkellaalmrfsmglkl
spselqrvreidancskhlsvvndiysyekelylctsvqilaqeadvtaeaakrvlfvmc
rewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttlrysv

SCOPe Domain Coordinates for d3bnxd_:

Click to download the PDB-style file with coordinates for d3bnxd_.
(The format of our PDB-style files is described here.)

Timeline for d3bnxd_: