Lineage for d3bnha_ (3bnh A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734319Family a.138.1.3: Di-heme elbow motif [48711] (8 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 2734414Protein automated matches [190276] (12 species)
    not a true protein
  7. 2734486Species Wolinella succinogenes [TaxId:844] [187217] (4 PDB entries)
  8. 2734489Domain d3bnha_: 3bnh A: [172718]
    automated match to d1fs7a_
    complexed with act, ca, hem, no2, so4, y1

Details for d3bnha_

PDB Entry: 3bnh (more details), 1.75 Å

PDB Description: w. succinogenes nrfa y218f nitrite complex
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d3bnha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bnha_ a.138.1.3 (A:) automated matches {Wolinella succinogenes [TaxId: 844]}
ktahsqgiegkamseewaryyprqfdswkktkesdnitdmlkekpalvvawagypfskdy
naprghyyalqdnintlrtgapvdgktgplpsacwtckspdvpriieqdgeleyftgkwa
kygdeivntigcynchddksaelkskvpyldrglsaagfktfaesthqekrslvcaqchv
efyfkktewkddkgvdktamvvtlpwskgisteqmeayydeinfadwthgisktpmlkaq
hpdwelyktgihgqkgvscadchmpytqegavkysdhkvgnpldnmdkscmnchreseqk
lkdivkqkferkeflqdiafdnigkahletgkamelgatdaelkeirthirhaqwradma
iaghgsffhapeevlrllasgneeaqkariklvkvlakygaidyvapdfetkekaqklak
vdmeafiaeklkfkqtleqewkkqaiakgrlnpeslkgvdekssyydktkk

SCOPe Domain Coordinates for d3bnha_:

Click to download the PDB-style file with coordinates for d3bnha_.
(The format of our PDB-style files is described here.)

Timeline for d3bnha_: