Lineage for d3blxi_ (3blx I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906266Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188333] (1 PDB entry)
  8. 2906275Domain d3blxi_: 3blx I: [172705]
    automated match to d1wpwa_

Details for d3blxi_

PDB Entry: 3blx (more details), 2.7 Å

PDB Description: Yeast Isocitrate Dehydrogenase (Apo Form)
PDB Compounds: (I:) Isocitrate dehydrogenase [NAD] subunit 1

SCOPe Domain Sequences for d3blxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3blxi_ c.77.1.0 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rftvtlipgdgvgkeitdsvrtifeaenipidwetinikqtdhkegvyeaveslkrnkig
lkglwhtpadqtghgslnvalrkqldiyanvalfkslkgvktripdidlivirentegef
sglehesvpgvveslkvmtrpkteriarfafdfakkynrksvtavhkanimklgdglfrn
iiteigqkeypdidvssiivdnasmqavakphqfdvlvtpsmygtilgnigaaliggpgl
vaganfgrdyavfepgsrhvgldikgqnvanptamilsstlmlnhlglneyatriskavh
etiaegkhttrdiggsssttdftneiinklstm

SCOPe Domain Coordinates for d3blxi_:

Click to download the PDB-style file with coordinates for d3blxi_.
(The format of our PDB-style files is described here.)

Timeline for d3blxi_: