Lineage for d3bl6a_ (3bl6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1860688Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1860705Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1860706Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1860764Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)
  7. 1860784Species Staphylococcus aureus [TaxId:1280] [188463] (1 PDB entry)
  8. 1860785Domain d3bl6a_: 3bl6 A: [172697]
    automated match to d1nc1a_
    complexed with fmc

Details for d3bl6a_

PDB Entry: 3bl6 (more details), 1.7 Å

PDB Description: Crystal structure of Staphylococcus aureus 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase in complex with formycin A
PDB Compounds: (A:) 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d3bl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bl6a_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Staphylococcus aureus [TaxId: 1280]}
ammigiigameeevtilknkltqlseisvahvkfytgilkdrevvitqsgigkvnaaist
tllinkfkpdviintgsagaldeslnvgdvlisddvkyhdadatafgyeygqipqmpvaf
qsskpliekvsqvvqqqqltakvglivsgdsfigsveqrqkikkafpnamavemeataia
qtcyqfnvpfvvvravsdlangeaemsfeaflekaavsssqtvealvsql

SCOPe Domain Coordinates for d3bl6a_:

Click to download the PDB-style file with coordinates for d3bl6a_.
(The format of our PDB-style files is described here.)

Timeline for d3bl6a_: