SCOPe 2.01: Domain d3bl6a_: 3bl6 A:

Lineage for d3bl6a_ (3bl6 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase [82448] (3 species)

7. Species Staphylococcus aureus [TaxId:1280] [188463] (1 PDB entry)

8. Domain d3bl6a_: 3bl6 A: [172697]
   automated match to d1nc1a_
   complexed with fmc

Details for d3bl6a_

PDB Entry: 3bl6, 1.7 Å

PDB Description: Crystal structure of Staphylococcus aureus 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase in complex with formycin A

PDB Compounds: (A:) 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d3bl6a_:

Sequence; same for both SEQRES and ATOM records:

>d3bl6a_ c.56.2.1 (A:) 5'-Methylthioadenosine/S-Adenosylhomocysteine nucleosidase {Staphylococcus aureus [TaxId: 1280]}
ammigiigameeevtilknkltqlseisvahvkfytgilkdrevvitqsgigkvnaaist
tllinkfkpdviintgsagaldeslnvgdvlisddvkyhdadatafgyeygqipqmpvaf
qsskpliekvsqvvqqqqltakvglivsgdsfigsveqrqkikkafpnamavemeataia
qtcyqfnvpfvvvravsdlangeaemsfeaflekaavsssqtvealvsql

Timeline for d3bl6a_:

• d3bl6a_ is new in SCOPe 2.01-stable
  
• d3bl6a_ appears in SCOPe 2.02
  
• d3bl6a_ appears in the current release, SCOPe 2.08, called d3bl6a1