SCOPe 2.06: Domain d3bkza_: 3bkz A:

Lineage for d3bkza_ (3bkz A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.10: AlkB-like [141628] (3 proteins)
   automatically mapped to Pfam PF13532

6. Protein Alkylated DNA repair protein AlkB [141629] (1 species)

7. Species Escherichia coli [TaxId:562] [141630] (10 PDB entries)
   Uniprot P05050 15-214

8. Domain d3bkza_: 3bkz A: [172695]
   automated match to d2fd8a1
   protein/DNA complex; complexed with akg, mn

Details for d3bkza_

PDB Entry: 3bkz, 1.65 Å

PDB Description: x-ray structure of e coli alkb crosslinked to dsdna in the active site

PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3bkza_:

Sequence; same for both SEQRES and ATOM records:

>d3bkza_ b.82.2.10 (A:) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqd
kcepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
agfhpltidcrynltfrqagk

Timeline for d3bkza_:

• d3bkza_ first appeared in SCOPe 2.01
  
• d3bkza_ appears in SCOPe 2.05
  
• d3bkza_ appears in SCOPe 2.07
  
• d3bkza_ appears in the current release, SCOPe 2.08