| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) ![]() |
| Family d.106.1.0: automated matches [191568] (1 protein) not a true family |
| Protein automated matches [190987] (4 species) not a true protein |
| Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [188685] (2 PDB entries) |
| Domain d3bksa_: 3bks A: [172694] automated match to d1pz4a_ complexed with plm |
PDB Entry: 3bks (more details), 2.1 Å
SCOPe Domain Sequences for d3bksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bksa_ d.106.1.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
alktdqildklneklaqvdrskrsftvilfvhlrqegkvvrsvvldfndlkiseielavt
stadypaeridasitiddndfylvatketsfaalieqgkvditgnkqafltldekfrnk
Timeline for d3bksa_: