Lineage for d3bkra_ (3bkr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968313Family d.106.1.0: automated matches [191568] (1 protein)
    not a true family
  6. 2968314Protein automated matches [190987] (4 species)
    not a true protein
  7. 2968338Species Yellow fever mosquito (Aedes aegypti) [TaxId:7159] [188685] (2 PDB entries)
  8. 2968339Domain d3bkra_: 3bkr A: [172693]
    automated match to d1pz4a_
    complexed with plm

Details for d3bkra_

PDB Entry: 3bkr (more details), 1.4 Å

PDB Description: Crystal Structure of Sterol Carrier Protein-2 like-3 (SCP2-L3) from Aedes Aegypti
PDB Compounds: (A:) Sterol Carrier Protein-2 like-3

SCOPe Domain Sequences for d3bkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bkra_ d.106.1.0 (A:) automated matches {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]}
alktdqildklneklaqvdrskrsftvilfvhlrqegkvvrsvvldfndlkiseielavt
stadypaeridasitiddndfylvatketsfaalieqgkvditgnkqafltldekfrnk

SCOPe Domain Coordinates for d3bkra_:

Click to download the PDB-style file with coordinates for d3bkra_.
(The format of our PDB-style files is described here.)

Timeline for d3bkra_: