Lineage for d3bknk_ (3bkn K:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265913Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1265914Protein automated matches [190036] (19 species)
    not a true protein
  7. 1265983Species Mycobacterium smegmatis [TaxId:246196] [188322] (6 PDB entries)
  8. 1266005Domain d3bknk_: 3bkn K: [172691]
    automated match to d1jgca_
    complexed with epe, hem, mg, zn

Details for d3bknk_

PDB Entry: 3bkn (more details), 2.72 Å

PDB Description: The structure of Mycobacterial bacterioferritin
PDB Compounds: (K:) bacterioferritin

SCOPe Domain Sequences for d3bknk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bknk_ a.25.1.0 (K:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd
rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll
eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa

SCOPe Domain Coordinates for d3bknk_:

Click to download the PDB-style file with coordinates for d3bknk_.
(The format of our PDB-style files is described here.)

Timeline for d3bknk_: