Class a: All alpha proteins [46456] (284 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (12 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [188322] (2 PDB entries) |
Domain d3bkne_: 3bkn E: [172685] automated match to d1jgca_ complexed with epe, hem, mg, zn |
PDB Entry: 3bkn (more details), 2.72 Å
SCOPe Domain Sequences for d3bkne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bkne_ a.25.1.0 (E:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa
Timeline for d3bkne_: