| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) ![]() |
| Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
| Protein automated matches [190139] (27 species) not a true protein |
| Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (4 PDB entries) |
| Domain d3bjwf_: 3bjw F: [172674] automated match to d1cl5a_ complexed with svr |
PDB Entry: 3bjw (more details), 2.3 Å
SCOPe Domain Sequences for d3bjwf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bjwf_ a.133.1.2 (F:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc
Timeline for d3bjwf_: