Lineage for d3bjwe_ (3bjw E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750246Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1750247Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1750252Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1750608Protein automated matches [190139] (25 species)
    not a true protein
  7. 1750741Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (3 PDB entries)
  8. 1750749Domain d3bjwe_: 3bjw E: [172673]
    automated match to d1cl5a_
    complexed with svr

Details for d3bjwe_

PDB Entry: 3bjw (more details), 2.3 Å

PDB Description: crystal structure of ecarpholin s complexed with suramin
PDB Compounds: (E:) phospholipase a2

SCOPe Domain Sequences for d3bjwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjwe_ a.133.1.2 (E:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc

SCOPe Domain Coordinates for d3bjwe_:

Click to download the PDB-style file with coordinates for d3bjwe_.
(The format of our PDB-style files is described here.)

Timeline for d3bjwe_: