Lineage for d3bjwa_ (3bjw A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925596Protein automated matches [190139] (19 species)
    not a true protein
  7. 925692Species Saw-scaled viper (Echis carinatus) [TaxId:40353] [188231] (3 PDB entries)
  8. 925696Domain d3bjwa_: 3bjw A: [172669]
    automated match to d1cl5a_
    complexed with svr

Details for d3bjwa_

PDB Entry: 3bjw (more details), 2.3 Å

PDB Description: crystal structure of ecarpholin s complexed with suramin
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d3bjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjwa_ a.133.1.2 (A:) automated matches {Saw-scaled viper (Echis carinatus) [TaxId: 40353]}
svvelgkmiiqetgkspfpsytsygcfcgggergppldatdrcclahsccydtlpdcspk
tdrykykrengeiicenstsckkricecdkavavclrknlntynkkytyypnfwckgdie
kc

SCOPe Domain Coordinates for d3bjwa_:

Click to download the PDB-style file with coordinates for d3bjwa_.
(The format of our PDB-style files is described here.)

Timeline for d3bjwa_: