Lineage for d3bjkc_ (3bjk C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1901753Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1901754Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1901755Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 1901861Protein automated matches [190155] (2 species)
    not a true protein
  7. 1901862Species Haemophilus influenzae [TaxId:71421] [188352] (1 PDB entry)
  8. 1901865Domain d3bjkc_: 3bjk C: [172664]
    automated match to d1ylia1
    complexed with cit, edo; mutant

Details for d3bjkc_

PDB Entry: 3bjk (more details), 1.9 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase: the asp44ala mutant enzyme
PDB Compounds: (C:) Acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d3bjkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjkc_ d.38.1.1 (C:) automated matches {Haemophilus influenzae [TaxId: 71421]}
grqskgvlllrtlampsdtnangdifggwimsqmamggailakeiahgrvvtvavesmnf
ikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnng
rsrtiprennqelekalaliseq

SCOPe Domain Coordinates for d3bjkc_:

Click to download the PDB-style file with coordinates for d3bjkc_.
(The format of our PDB-style files is described here.)

Timeline for d3bjkc_: