SCOPe 2.07: Domain d3bjkb_: 3bjk B:

Lineage for d3bjkb_ (3bjk B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein automated matches [190155] (3 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries)

8. Domain d3bjkb_: 3bjk B: [172663]
   automated match to d1ylia1
   complexed with cit, edo; mutant

Details for d3bjkb_

PDB Entry: 3bjk, 1.9 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase: the asp44ala mutant enzyme

PDB Compounds: (B:) Acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d3bjkb_:

Sequence; same for both SEQRES and ATOM records:

>d3bjkb_ d.38.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
grqskgvlllrtlampsdtnangdifggwimsqmamggailakeiahgrvvtvavesmnf
ikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnng
rsrtiprennqelekalalise

Timeline for d3bjkb_:

• d3bjkb_ first appeared in SCOPe 2.01
  
• d3bjkb_ appears in SCOPe 2.06
  
• d3bjkb_ appears in the current release, SCOPe 2.08