Lineage for d3bjkb_ (3bjk B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943647Protein automated matches [190155] (3 species)
    not a true protein
  7. 2943661Species Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries)
  8. 2943663Domain d3bjkb_: 3bjk B: [172663]
    automated match to d1ylia1
    complexed with cit, edo; mutant

Details for d3bjkb_

PDB Entry: 3bjk (more details), 1.9 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase: the asp44ala mutant enzyme
PDB Compounds: (B:) Acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d3bjkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjkb_ d.38.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
grqskgvlllrtlampsdtnangdifggwimsqmamggailakeiahgrvvtvavesmnf
ikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnng
rsrtiprennqelekalalise

SCOPe Domain Coordinates for d3bjkb_:

Click to download the PDB-style file with coordinates for d3bjkb_.
(The format of our PDB-style files is described here.)

Timeline for d3bjkb_: