| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
| Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
| Protein automated matches [190155] (2 species) not a true protein |
| Species Haemophilus influenzae [TaxId:71421] [188352] (1 PDB entry) |
| Domain d3bjka_: 3bjk A: [172662] automated match to d1ylia1 complexed with cit, edo; mutant |
PDB Entry: 3bjk (more details), 1.9 Å
SCOPe Domain Sequences for d3bjka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bjka_ d.38.1.1 (A:) automated matches {Haemophilus influenzae [TaxId: 71421]}
skgvlllrtlampsdtnangdifggwimsqmamggailakeiahgrvvtvavesmnfikp
isvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngrsr
tiprennqelekalaliseq
Timeline for d3bjka_: