Lineage for d3bjaa1 (3bja A:1-138)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694563Species Bacillus cereus [TaxId:222523] [188293] (2 PDB entries)
  8. 2694565Domain d3bjaa1: 3bja A:1-138 [172659]
    Other proteins in same PDB: d3bjaa2
    automated match to d2a61a1

Details for d3bjaa1

PDB Entry: 3bja (more details), 2.38 Å

PDB Description: crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution
PDB Compounds: (A:) Transcriptional regulator, MarR family, putative

SCOPe Domain Sequences for d3bjaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bjaa1 a.4.5.0 (A:1-138) automated matches {Bacillus cereus [TaxId: 222523]}
mnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcvp
snmttmiqrmkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcftk
eeegiledlllkwkkhln

SCOPe Domain Coordinates for d3bjaa1:

Click to download the PDB-style file with coordinates for d3bjaa1.
(The format of our PDB-style files is described here.)

Timeline for d3bjaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bjaa2