![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:222523] [188293] (2 PDB entries) |
![]() | Domain d3bjaa1: 3bja A:1-138 [172659] Other proteins in same PDB: d3bjaa2 automated match to d2a61a1 |
PDB Entry: 3bja (more details), 2.38 Å
SCOPe Domain Sequences for d3bjaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bjaa1 a.4.5.0 (A:1-138) automated matches {Bacillus cereus [TaxId: 222523]} mnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcvp snmttmiqrmkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcftk eeegiledlllkwkkhln
Timeline for d3bjaa1: