SCOPe 2.08: Domain d3bjaa1: 3bja A:1-138

Lineage for d3bjaa1 (3bja A:1-138)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Bacillus cereus [TaxId:222523] [188293] (2 PDB entries)

8. Domain d3bjaa1: 3bja A:1-138 [172659]
   Other proteins in same PDB: d3bjaa2
   automated match to d2a61a1

Details for d3bjaa1

PDB Entry: 3bja, 2.38 Å

PDB Description: crystal structure of putative marr-like transcription regulator (np_978771.1) from bacillus cereus atcc 10987 at 2.38 a resolution

PDB Compounds: (A:) Transcriptional regulator, MarR family, putative

SCOPe Domain Sequences for d3bjaa1:

Sequence; same for both SEQRES and ATOM records:

>d3bjaa1 a.4.5.0 (A:1-138) automated matches {Bacillus cereus [TaxId: 222523]}
mnnrelygnirdvyhllqknldkaieqydisyvqfgviqvlaksgkvsmsklienmgcvp
snmttmiqrmkrdgyvmteknpndqretlvyltkkgeetkkqvdvqysdflkencgcftk
eeegiledlllkwkkhln

Timeline for d3bjaa1:

• d3bjaa1 first appeared in SCOPe 2.01, called d3bjaa_
  
• d3bjaa1 appears in SCOPe 2.07