Lineage for d3bixd1 (3bix D:52-638)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136449Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (8 PDB entries)
  8. 2136453Domain d3bixd1: 3bix D:52-638 [172650]
    Other proteins in same PDB: d3bixa2, d3bixb2, d3bixc2, d3bixd2
    automated match to d1j06a_
    complexed with edo, nag, ni

Details for d3bixd1

PDB Entry: 3bix (more details), 1.8 Å

PDB Description: crystal structure of the extracellular esterase domain of neuroligin-1
PDB Compounds: (D:) Neuroligin-1

SCOPe Domain Sequences for d3bixd1:

Sequence, based on SEQRES records: (download)

>d3bixd1 c.69.1.0 (D:52-638) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dplvttnfgkirgikkelnneilgpviqflgvpyaapptgehrfqppeppspwsdirnat
qfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvpteddirdsgg
pkpvmvyihggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnygl
ldliqalrwtsenigffggdplritvfgsgaggscvnlltlshysekglfqraiaqsgta
lsswavsfqpakyarilatkvgcnvsdtvelveclqkkpykelvdqdvqparyhiafgpv
idgdvipddpqilmeqgeflnydimlgvnqgeglkfvenivdsddgvsasdfdfavsnfv
dnlygypegkdvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnf
gsptyfyafyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavv
mtywtnfaktgdpnqpvpqdtkfihtkpnrfeevawtrysqkdqlylhiglkprvkehyr
ankvnlwlelvphlhnlnd

Sequence, based on observed residues (ATOM records): (download)

>d3bixd1 c.69.1.0 (D:52-638) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dplvttnfgkirgikkelnneilgpviqflgvpyaapptgehrfqppeppspwsdirnat
qfapvcpqniidgrlpevmlpvwftnnldvvssyvqdqsedclylniyvptgpkpvmvyi
hggsymegtgnlydgsvlasygnvivitvnyrlgvlgflstgdqaakgnyglldliqalr
wtsenigffggdplritvfgsgaggscvnlltlshysekglfqraiaqsgtalsswavsf
qpakyarilatkvgcnvsdtvelveclqkkpykelvdqdvqparyhiafgpvidgdvipd
dpqilmeqgeflnydimlgvnqgeglkfvenivdsddgvsasdfdfavsnfvdnlygype
gkdvlretikfmytdwadrhnpetrrktllalftdhqwvapavatadlhsnfgsptyfya
fyhhcqtdqvpawadaahgdevpyvlgipmigptelfpcnfskndvmlsavvmtywtnfa
ktgdpnqpvpqdtkfihtkpnrfeevawtrysqkdqlylhiglkprvkehyrankvnlwl
elvphlhnlnd

SCOPe Domain Coordinates for d3bixd1:

Click to download the PDB-style file with coordinates for d3bixd1.
(The format of our PDB-style files is described here.)

Timeline for d3bixd1: