Lineage for d3biea_ (3bie A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815739Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2815743Protein Alkylated DNA repair protein AlkB [141629] (1 species)
  7. 2815744Species Escherichia coli [TaxId:562] [141630] (11 PDB entries)
    Uniprot P05050 15-214
  8. 2815747Domain d3biea_: 3bie A: [172644]
    automated match to d2fd8a1
    protein/DNA complex; complexed with akg, mn

Details for d3biea_

PDB Entry: 3bie (more details), 1.68 Å

PDB Description: x-ray structure of e coli alkb bound to dsdna containing 1mea/t with mn and 2kg
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3biea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3biea_ b.82.2.10 (A:) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d3biea_:

Click to download the PDB-style file with coordinates for d3biea_.
(The format of our PDB-style files is described here.)

Timeline for d3biea_: