SCOPe 2.06: Domain d3bhra_: 3bhr A:

Lineage for d3bhra_ (3bhr A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (67 PDB entries)

8. Domain d3bhra_: 3bhr A: [172642]
   automated match to d1aiqa_
   protein/RNA complex; complexed with ndu, po4, thg

Details for d3bhra_

PDB Entry: 3bhr, 1.9 Å

PDB Description: e. coli ts complexed with 5-no2dump and tetrahydrofolate at 1.9 a resolution (space group 152)

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3bhra_:

Sequence; same for both SEQRES and ATOM records:

>d3bhra_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d3bhra_:

• d3bhra_ first appeared in SCOPe 2.01
  
• d3bhra_ appears in SCOPe 2.05
  
• d3bhra_ appears in SCOPe 2.07
  
• d3bhra_ appears in the current release, SCOPe 2.08