SCOPe 2.06: Domain d3bhpc1: 3bhp C:1-52

Lineage for d3bhpc1 (3bhp C:1-52)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.21: YnzC-like [158221] (1 family)

5. Family a.2.21.1: YznC-like [158222] (2 proteins)
   Pfam PF05979; DUF896

6. Protein automated matches [190889] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188291] (2 PDB entries)

8. Domain d3bhpc1: 3bhp C:1-52 [172641]
   Other proteins in same PDB: d3bhpc2
   automated match to d2hepa1

Details for d3bhpc1

PDB Entry: 3bhp, 2.01 Å

PDB Description: Crystal structure of UPF0291 protein ynzC from Bacillus subtilis at resolution 2.0 A. Northeast Structural Genomics Consortium target SR384

PDB Compounds: (C:) UPF0291 protein ynzC

SCOPe Domain Sequences for d3bhpc1:

Sequence; same for both SEQRES and ATOM records:

>d3bhpc1 a.2.21.1 (C:1-52) automated matches {Bacillus subtilis [TaxId: 1423]}
misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmkntlksv

Timeline for d3bhpc1:

• d3bhpc1 first appeared in SCOPe 2.01, called d3bhpc_
  
• d3bhpc1 was called d3bhpc_ in SCOPe 2.05
  
• d3bhpc1 appears in SCOPe 2.07
  
• d3bhpc1 appears in the current release, SCOPe 2.08