Lineage for d3bhpb_ (3bhp B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690785Superfamily a.2.21: YnzC-like [158221] (1 family) (S)
  5. 2690786Family a.2.21.1: YznC-like [158222] (2 proteins)
    Pfam PF05979; DUF896
  6. 2690790Protein automated matches [190889] (1 species)
    not a true protein
  7. 2690791Species Bacillus subtilis [TaxId:1423] [188291] (2 PDB entries)
  8. 2690793Domain d3bhpb_: 3bhp B: [172640]
    Other proteins in same PDB: d3bhpc2
    automated match to d2hepa1

Details for d3bhpb_

PDB Entry: 3bhp (more details), 2.01 Å

PDB Description: Crystal structure of UPF0291 protein ynzC from Bacillus subtilis at resolution 2.0 A. Northeast Structural Genomics Consortium target SR384
PDB Compounds: (B:) UPF0291 protein ynzC

SCOPe Domain Sequences for d3bhpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bhpb_ a.2.21.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmknt

SCOPe Domain Coordinates for d3bhpb_:

Click to download the PDB-style file with coordinates for d3bhpb_.
(The format of our PDB-style files is described here.)

Timeline for d3bhpb_: