| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.21: YnzC-like [158221] (1 family) ![]() |
| Family a.2.21.1: YznC-like [158222] (2 proteins) Pfam PF05979; DUF896 |
| Protein automated matches [190889] (1 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [188291] (2 PDB entries) |
| Domain d3bhpb_: 3bhp B: [172640] Other proteins in same PDB: d3bhpc2 automated match to d2hepa1 |
PDB Entry: 3bhp (more details), 2.01 Å
SCOPe Domain Sequences for d3bhpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bhpb_ a.2.21.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
misnakiarinelaakakagviteeekaeqqklrqeylkgfrssmknt
Timeline for d3bhpb_: