SCOPe 2.01: Domain d3bhla_: 3bhl A:

Lineage for d3bhla_ (3bhl A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family)

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein Thymidylate synthase [55833] (7 species)

7. Species Escherichia coli [TaxId:562] [55834] (63 PDB entries)

8. Domain d3bhla_: 3bhl A: [172637]
   automated match to d1aiqa_
   protein/RNA complex; complexed with ndu, so4, thg

Details for d3bhla_

PDB Entry: 3bhl, 1.4 Å

PDB Description: E.coli thymidylate synthase complexes with 5-NO2dUMP and tetrahydrofolate at 1.4 A resolution

PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3bhla_:

Sequence; same for both SEQRES and ATOM records:

>d3bhla_ d.117.1.1 (A:) Thymidylate synthase {Escherichia coli [TaxId: 562]}
mkqylelmqkvldegtqkndrtgtgtlsifghqmrfnlqdgfplvttkrchlrsiihell
wflqgdtniaylhennvtiwdewadengdlgpvygkqwrawptpdgrhidqittvlnqlk
ndpdsrriivsawnvgeldkmalapchaffqfyvadgklscqlyqrscdvflglpfnias
yallvhmmaqqcdlevgdfvwtggdthlysnhmdqthlqlsreprplpkliikrkpesif
dyrfedfeiegydphpgikapvai

Timeline for d3bhla_:

• d3bhla_ is new in SCOPe 2.01-stable
  
• d3bhla_ appears in SCOPe 2.02
  
• d3bhla_ appears in the current release, SCOPe 2.08