Lineage for d3bgop1 (3bgo P:9-77)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2193180Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2193201Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
    decorated with additional structure
  6. 2193214Protein automated matches [190926] (1 species)
    not a true protein
  7. 2193215Species Bacillus amyloliquefaciens [TaxId:1390] [188457] (3 PDB entries)
  8. 2193217Domain d3bgop1: 3bgo P:9-77 [172623]
    Other proteins in same PDB: d3bgop2, d3bgos_
    automated match to d1spbp_
    complexed with azi, zn

Details for d3bgop1

PDB Entry: 3bgo (more details), 1.8 Å

PDB Description: azide complex of engineered subtilisin subt_bacam
PDB Compounds: (P:) subtilisin bpn'

SCOPe Domain Sequences for d3bgop1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bgop1 d.58.3.2 (P:9-77) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv
eedklyral

SCOPe Domain Coordinates for d3bgop1:

Click to download the PDB-style file with coordinates for d3bgop1.
(The format of our PDB-style files is described here.)

Timeline for d3bgop1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bgop2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bgos_