| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) ![]() |
| Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins) decorated with additional structure |
| Protein automated matches [190926] (1 species) not a true protein |
| Species Bacillus amyloliquefaciens [TaxId:1390] [188457] (3 PDB entries) |
| Domain d3bgop_: 3bgo P: [172623] Other proteins in same PDB: d3bgos_ automated match to d1spbp_ complexed with azi, zn |
PDB Entry: 3bgo (more details), 1.8 Å
SCOPe Domain Sequences for d3bgop_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bgop_ d.58.3.2 (P:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv
eedklyralsa
Timeline for d3bgop_: