SCOPe 2.01: Domain d3bgop_: 3bgo P:

Lineage for d3bgop_ (3bgo P:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (3 families)

5. Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
   decorated with additional structure

6. Protein automated matches [190926] (1 species)
   not a true protein

7. Species Bacillus amyloliquefaciens [TaxId:1390] [188457] (3 PDB entries)

8. Domain d3bgop_: 3bgo P: [172623]
   Other proteins in same PDB: d3bgos_
   automated match to d1spbp_
   complexed with azi, zn

Details for d3bgop_

PDB Entry: 3bgo, 1.8 Å

PDB Description: azide complex of engineered subtilisin subt_bacam

PDB Compounds: (P:) subtilisin bpn'

SCOPe Domain Sequences for d3bgop_:

Sequence; same for both SEQRES and ATOM records:

>d3bgop_ d.58.3.2 (P:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv
eedklyralsa

Timeline for d3bgop_:

• d3bgop_ is new in SCOPe 2.01-stable
  
• d3bgop_ appears in SCOPe 2.02
  
• d3bgop_ appears in the current release, SCOPe 2.08, called d3bgop1