Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) |
Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins) decorated with additional structure |
Protein automated matches [190926] (1 species) not a true protein |
Species Bacillus amyloliquefaciens [TaxId:1390] [188457] (3 PDB entries) |
Domain d3bgop1: 3bgo P:9-77 [172623] Other proteins in same PDB: d3bgop2, d3bgos_ automated match to d1spbp_ complexed with azi, zn |
PDB Entry: 3bgo (more details), 1.8 Å
SCOPe Domain Sequences for d3bgop1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bgop1 d.58.3.2 (P:9-77) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} ekkyivgfkqgfkscakkedvisekggklqkcfkyvdaasatlnekaveelkkdpsvayv eedklyral
Timeline for d3bgop1: