Lineage for d3bg8a_ (3bg8 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1793083Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1793084Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1793331Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 1793669Protein Coagulation factor XI [117237] (1 species)
  7. 1793670Species Human (Homo sapiens) [TaxId:9606] [117238] (32 PDB entries)
    Uniprot P03951 388-624
  8. 1793671Domain d3bg8a_: 3bg8 A: [172622]
    automated match to d1xx9b_
    complexed with ben, inh, so4

Details for d3bg8a_

PDB Entry: 3bg8 (more details), 1.6 Å

PDB Description: crystal structure of factor xia in complex with clavatadine a
PDB Compounds: (A:) Coagulation factor XIa light chain

SCOPe Domain Sequences for d3bg8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bg8a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpislpskger
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d3bg8a_:

Click to download the PDB-style file with coordinates for d3bg8a_.
(The format of our PDB-style files is described here.)

Timeline for d3bg8a_: