SCOPe 2.08: Domain d1c7va_: 1c7v A:

Lineage for d1c7va_ (1c7v A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium vector protein [47514] (1 species)

7. Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47515] (4 PDB entries)

8. Domain d1c7va_: 1c7v A: [17262]
   C-terminal domain (w81-s161)
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1c7va_

PDB Entry: 1c7v

PDB Description: nmr solution structure of the calcium-bound c-terminal domain (w81- s161) of calcium vector protein from amphioxus

PDB Compounds: (A:) calcium vector protein

SCOPe Domain Sequences for d1c7va_:

Sequence; same for both SEQRES and ATOM records:

>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
eeeilrafkvfdangdgvidfdefkfimqkvgeepltdaeveeamkeadedgngvidipe
fmdlikks

Timeline for d1c7va_:

• d1c7va_ first appeared (with stable ids) in SCOP 1.55
  
• d1c7va_ appears in SCOPe 2.07