Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (24 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [188290] (1 PDB entry) |
Domain d3bfke_: 3bfk E: [172617] automated match to d1oiva_ complexed with gdp, gol |
PDB Entry: 3bfk (more details), 1.8 Å
SCOPe Domain Sequences for d3bfke_:
Sequence, based on SEQRES records: (download)
>d3bfke_ c.37.1.8 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]} dyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqi wdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgn ksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynv
>d3bfke_ c.37.1.8 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]} dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlkiikaqiwdtaraits ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd atqyakkeklafietsaleatnvelafhqllneiynv
Timeline for d3bfke_:
View in 3D Domains from other chains: (mouse over for more information) d3bfka_, d3bfkb_, d3bfkc_, d3bfkd_ |