Lineage for d3bfke_ (3bfk E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868705Species Plasmodium falciparum [TaxId:36329] [188290] (1 PDB entry)
  8. 2868710Domain d3bfke_: 3bfk E: [172617]
    automated match to d1oiva_
    complexed with gdp, gol

Details for d3bfke_

PDB Entry: 3bfk (more details), 1.8 Å

PDB Description: crystal structure of plasmodium falciparum rab11a in complex with gdp
PDB Compounds: (E:) Small GTPase Rab11

SCOPe Domain Sequences for d3bfke_:

Sequence, based on SEQRES records: (download)

>d3bfke_ c.37.1.8 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dyydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqi
wdtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgn
ksdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynv

Sequence, based on observed residues (ATOM records): (download)

>d3bfke_ c.37.1.8 (E:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dyydylfkivligdsgvgksnllsrftrdefnlgvefatksiqlkiikaqiwdtaraits
ayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrvindnd
atqyakkeklafietsaleatnvelafhqllneiynv

SCOPe Domain Coordinates for d3bfke_:

Click to download the PDB-style file with coordinates for d3bfke_.
(The format of our PDB-style files is described here.)

Timeline for d3bfke_: