| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein automated matches [190047] (37 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [188290] (1 PDB entry) |
| Domain d3bfkc_: 3bfk C: [172615] automated match to d1oiva_ complexed with gdp, gol |
PDB Entry: 3bfk (more details), 1.8 Å
SCOPe Domain Sequences for d3bfkc_:
Sequence, based on SEQRES records: (download)
>d3bfkc_ c.37.1.8 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
yydylfkivligdsgvgksnllsrftrdefnleskstigvefatksiqlknnkiikaqiw
dtagqeryraitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnk
sdlkhlrvindndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatkn
>d3bfkc_ c.37.1.8 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
yydylfkivligdsgvgksnllsrftrdefnleskgvefatksiqlknnkiikaqiwdta
gaitsayyrgavgallvyditkknsfeniekwlkelrdnadsnivillvgnksdlkhlrv
indndatqyakkeklafietsaleatnvelafhqllneiynvrqkkqatkn
Timeline for d3bfkc_:
View in 3DDomains from other chains: (mouse over for more information) d3bfka_, d3bfkb_, d3bfkd_, d3bfke_ |