Lineage for d1ej3b_ (1ej3 B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) Fold a.39: EF Hand-like [47472] (3 superfamilies) Superfamily a.39.1: EF-hand [47473] (7 families) 
Family a.39.1.5: Calmodulin-like [47502] (13 proteins) 
Protein Aequorin [47512] (1 species) Species Jellyfish (Aequorea aequorea) [47513] (1 PDB entry) 
Domain d1ej3b_: 1ej3 B: [17260]
Details for d1ej3b_
PDB Entry: 1ej3 (more details), 2.3 Å
PDB Description: crystal structure of aequorin
SCOP Domain Sequences for d1ej3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej3b_ a.39.1.5 (B:) Aequorin {Jellyfish (Aequorea aequorea)}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp
SCOP Domain Coordinates for d1ej3b_:
Click to download the PDB-style file with coordinates for d1ej3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ej3b_:
- d1ej3b_ appears in SCOP 1.57
- d1ej3b_ appears in the current release, SCOPe 2.08
View in 3D
