Lineage for d1ej3b_ (1ej3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710588Protein Calcium-regulated photoprotein [47512] (4 species)
    structurally most similar to sarcoplasmic calcium-binding protein
  7. 2710600Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (1 PDB entry)
  8. 2710602Domain d1ej3b_: 1ej3 B: [17260]
    complexed with czh
    has additional insertions and/or extensions that are not grouped together

Details for d1ej3b_

PDB Entry: 1ej3 (more details), 2.3 Å

PDB Description: crystal structure of aequorin
PDB Compounds: (B:) aequorin

SCOPe Domain Sequences for d1ej3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej3b_ a.39.1.5 (B:) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

SCOPe Domain Coordinates for d1ej3b_:

Click to download the PDB-style file with coordinates for d1ej3b_.
(The format of our PDB-style files is described here.)

Timeline for d1ej3b_: