Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcium-regulated photoprotein [47512] (4 species) structurally most similar to sarcoplasmic calcium-binding protein |
Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (1 PDB entry) |
Domain d1ej3b_: 1ej3 B: [17260] complexed with czh has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ej3 (more details), 2.3 Å
SCOPe Domain Sequences for d1ej3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej3b_ a.39.1.5 (B:) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek lyggavp
Timeline for d1ej3b_: