SCOP 1.61: Domain d1ej3a_: 1ej3 A:

Lineage for d1ej3a_ (1ej3 A:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)

4. Superfamily a.39.1: EF-hand [47473] (8 families)

5. Family a.39.1.5: Calmodulin-like [47502] (16 proteins)

6. Protein Calcium-regulated photoprotein [47512] (3 species)

7. Species Jellyfish (Aequorea aequorea), aequorin [TaxId:168712] [47513] (1 PDB entry)

8. Domain d1ej3a_: 1ej3 A: [17259]

Details for d1ej3a_

PDB Entry: 1ej3, 2.3 Å

PDB Description: crystal structure of aequorin

SCOP Domain Sequences for d1ej3a_:

Sequence; same for both SEQRES and ATOM records:

>d1ej3a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin}
ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
lyggavp

Timeline for d1ej3a_:

• d1ej3a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ej3a_ appears in SCOP 1.59
  
• d1ej3a_ appears in SCOP 1.63
  
• d1ej3a_ appears in the current release, SCOPe 2.08