Lineage for d3bfeb_ (3bfe B:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1054955Species Citrobacter sedlakii [TaxId:67826] [188289] (3 PDB entries)
  8. 1054962Domain d3bfeb_: 3bfe B: [172587]
    automated match to d1iyoa_
    complexed with scn

Details for d3bfeb_

PDB Entry: 3bfe (more details), 2.4 Å

PDB Description: Crystal Structure of the Class A beta-lactamase SED-1 from Citrobacter sedlakii
PDB Compounds: (B:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bfeb_ e.3.1.1 (B:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset
hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg
nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq
lvdwlkgnttggqsiraglpahwvvgdktgagdygttndiaviwpedraplvlvtyftqp
qqdakwrkdvlaaaakivtegk

SCOPe Domain Coordinates for d3bfeb_:

Click to download the PDB-style file with coordinates for d3bfeb_.
(The format of our PDB-style files is described here.)

Timeline for d3bfeb_: