SCOPe 2.01: Domain d3bfea_: 3bfe A:

Lineage for d3bfea_ (3bfe A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (13 species)
   not a true protein

7. Species Citrobacter sedlakii [TaxId:67826] [188289] (3 PDB entries)

8. Domain d3bfea_: 3bfe A: [172586]
   automated match to d1iyoa_
   complexed with scn

Details for d3bfea_

PDB Entry: 3bfe, 2.4 Å

PDB Description: Crystal Structure of the Class A beta-lactamase SED-1 from Citrobacter sedlakii

PDB Compounds: (A:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfea_:

Sequence; same for both SEQRES and ATOM records:

>d3bfea_ e.3.1.1 (A:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset
hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg
nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq
lvdwlkgnttggqsiraglpahwvvgdktgagdygttndiaviwpedraplvlvtyftqp
qqdakwrkdvlaaaakivtegk

Timeline for d3bfea_:

• d3bfea_ is new in SCOPe 2.01-stable
  
• d3bfea_ appears in SCOPe 2.02
  
• d3bfea_ appears in the current release, SCOPe 2.08