Lineage for d2sasa_ (2sas A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1087980Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1088379Protein Sarcoplasmic calcium-binding protein [47509] (2 species)
  7. 1088380Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47511] (1 PDB entry)
  8. 1088381Domain d2sasa_: 2sas A: [17258]
    complexed with ca

Details for d2sasa_

PDB Entry: 2sas (more details), 2.4 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution
PDB Compounds: (A:) Sarcoplasmic calcium-binding protein

SCOPe Domain Sequences for d2sasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
mgqkp

SCOPe Domain Coordinates for d2sasa_:

Click to download the PDB-style file with coordinates for d2sasa_.
(The format of our PDB-style files is described here.)

Timeline for d2sasa_: