Lineage for d2sas__ (2sas -)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97470Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 97604Protein Sarcoplasmic calcium-binding protein [47509] (2 species)
  7. 97605Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [47511] (1 PDB entry)
  8. 97606Domain d2sas__: 2sas - [17258]

Details for d2sas__

PDB Entry: 2sas (more details), 2.4 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from amphioxus refined at 2.4 angstroms resolution

SCOP Domain Sequences for d2sas__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sas__ a.39.1.5 (-) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum)}
glndfqkqkikftfdffldmnhdgsiqdndfedmmtrykevnkgslsdadyksmqasled
ewrdlkgradinkddvvsweeylamwektiatcksvadlpawcqnripflfkgmdvsgdg
ivdleefqnycknfqlqcadvpavynvitdggkvtfdlnrykelyyrlltspaadagntl
mgqkp

SCOP Domain Coordinates for d2sas__:

Click to download the PDB-style file with coordinates for d2sas__.
(The format of our PDB-style files is described here.)

Timeline for d2sas__: