SCOPe 2.07: Domain d3bewe_: 3bew E:

Lineage for d3bewe_ (3bew E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [188287] (25 PDB entries)

8. Domain d3bewe_: 3bew E: [172579]
   automated match to d1hlam_

Details for d3bewe_

PDB Entry: 3bew, 2.6 Å

PDB Description: 10mer Crystal Structure of chicken MHC class I haplotype B21

PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3bewe_:

Sequence; same for both SEQRES and ATOM records:

>d3bewe_ b.1.1.0 (E:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mdltpkvqvysrfpasagtknvlncfaagfhppkisitlmkdgvpmegaqysdmsfnddw
tfqrlvhadftpssgstyackvehetlkepqvykwdpef

Timeline for d3bewe_:

• d3bewe_ first appeared in SCOPe 2.01
  
• d3bewe_ appears in SCOPe 2.06
  
• d3bewe_ appears in the current release, SCOPe 2.08