SCOPe 2.02: Domain d3beub_: 3beu B:

Lineage for d3beub_ (3beu B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein Trypsin [50504] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (6 PDB entries)

8. Domain d3beub_: 3beu B: [172576]
   automated match to d1os8a_
   complexed with ben, ca, na, so4

Details for d3beub_

PDB Entry: 3beu, 1.05 Å

PDB Description: na+-dependent allostery mediates coagulation factor protease active site selectivity

PDB Compounds: (B:) Trypsin

SCOPe Domain Sequences for d3beub_:

Sequence; same for both SEQRES and ATOM records:

>d3beub_ b.47.1.1 (B:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqss
savkvrstkvlqapgftketygkdwaliklaqpinqptlkiatttaynqgtftvagwgan
reggsqqryllkanvpfvsdaacrssssfilvanemicagydtkqedtcqgdsggpmfrk
dnadewvqvgivswgegcarkgkygvytevstfasaiasaartl

Timeline for d3beub_:

• d3beub_ first appeared in SCOPe 2.01
  
• d3beub_ appears in SCOPe 2.03
  
• d3beub_ appears in the current release, SCOPe 2.08