Lineage for d3beub_ (3beu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794771Protein Trypsin [50504] (1 species)
  7. 2794772Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (7 PDB entries)
  8. 2794774Domain d3beub_: 3beu B: [172576]
    automated match to d1os8a_
    complexed with ben, ca, na, so4

Details for d3beub_

PDB Entry: 3beu (more details), 1.05 Å

PDB Description: na+-dependent allostery mediates coagulation factor protease active site selectivity
PDB Compounds: (B:) Trypsin

SCOPe Domain Sequences for d3beub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3beub_ b.47.1.1 (B:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqss
savkvrstkvlqapgftketygkdwaliklaqpinqptlkiatttaynqgtftvagwgan
reggsqqryllkanvpfvsdaacrssssfilvanemicagydtkqedtcqgdsggpmfrk
dnadewvqvgivswgegcarkgkygvytevstfasaiasaartl

SCOPe Domain Coordinates for d3beub_:

Click to download the PDB-style file with coordinates for d3beub_.
(The format of our PDB-style files is described here.)

Timeline for d3beub_: