Lineage for d3bema_ (3bem A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) 
Family d.90.1.0: automated matches [191446] (1 protein)
not a true familyProtein automated matches [190672] (21 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [188288] (2 PDB entries) 
Domain d3bema_: 3bem A: [172571]
automated match to d2b67a1
complexed with act, fmn, ni, pgo
Details for d3bema_
PDB Entry: 3bem (more details), 1.65 Å
PDB Description: crystal structure of putative nitroreductase ydfn (2632848) from bacillus subtilis at 1.65 a resolution
PDB Compounds: (A:) Putative NAD(P)H nitroreductase ydfNSCOPe Domain Sequences for d3bema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bema_ d.90.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
hmaefthlvnerrsasnflsghpitkedlnemfelvalapsafnlqhtkyvtvldqdvke
klkqaangqykvvsssavllvlgdkqayqqaadiyeglkvlgilnkqeydhmvqdtvsfy
enrgeqfkrdeairnaslsammfmlsaaaagwdtcpmigfdaeavkrilniddqfevvmm
itigkektesrrprgyrkpvnefveym
SCOPe Domain Coordinates for d3bema_:
Click to download the PDB-style file with coordinates for d3bema_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bema_:
- d3bema_ first appeared in SCOPe 2.01
- d3bema_ appears in SCOPe 2.04
- d3bema_ is called d3bema1 in SCOPe 2.06
- d3bema_ appears in the current release, SCOPe 2.08, called d3bema1
View in 3D
