![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily) core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243 |
![]() | Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) ![]() |
![]() | Family d.90.1.0: automated matches [191446] (1 protein) not a true family |
![]() | Protein automated matches [190672] (21 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [188288] (2 PDB entries) |
![]() | Domain d3bema_: 3bem A: [172571] automated match to d2b67a1 complexed with act, fmn, ni, pgo |
PDB Entry: 3bem (more details), 1.65 Å
SCOPe Domain Sequences for d3bema_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bema_ d.90.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} hmaefthlvnerrsasnflsghpitkedlnemfelvalapsafnlqhtkyvtvldqdvke klkqaangqykvvsssavllvlgdkqayqqaadiyeglkvlgilnkqeydhmvqdtvsfy enrgeqfkrdeairnaslsammfmlsaaaagwdtcpmigfdaeavkrilniddqfevvmm itigkektesrrprgyrkpvnefveym
Timeline for d3bema_: