Lineage for d2scpb_ (2scp B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97470Family a.39.1.5: Calmodulin-like [47502] (15 proteins)
  6. 97604Protein Sarcoplasmic calcium-binding protein [47509] (2 species)
  7. 97607Species Sandworm (Nereis diversicolor) [TaxId:126592] [47510] (1 PDB entry)
  8. 97609Domain d2scpb_: 2scp B: [17257]

Details for d2scpb_

PDB Entry: 2scp (more details), 2 Å

PDB Description: structure of a sarcoplasmic calcium-binding protein from nereis diversicolor refined at 2.0 angstroms resolution

SCOP Domain Sequences for d2scpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2scpb_ a.39.1.5 (B:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor)}
sdlwvqkmktyfnridfdkdgaitrmdfesmaerfakesemkaehakvlmdsltgvwdnf
ltavaggkgidettfinsmkemvknpeaksvvegplplffravdtnednnisrdeygiff
gmlgldktmapasfdaidtnndgllsleefviagsdffmndgdstnkvfwgplv

SCOP Domain Coordinates for d2scpb_:

Click to download the PDB-style file with coordinates for d2scpb_.
(The format of our PDB-style files is described here.)

Timeline for d2scpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2scpa_