Lineage for d3be2a1 (3be2 A:815-1171)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545083Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2545084Species Human (Homo sapiens) [TaxId:9606] [56161] (25 PDB entries)
  8. 2545090Domain d3be2a1: 3be2 A:815-1171 [172569]
    Other proteins in same PDB: d3be2a2
    automated match to d1vr2a_
    complexed with raj

Details for d3be2a1

PDB Entry: 3be2 (more details), 1.75 Å

PDB Description: crystal structure of the vegfr2 kinase domain in complex with a benzamide inhibitor
PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d3be2a1:

Sequence, based on SEQRES records: (download)

>d3be2a1 d.144.1.7 (A:815-1171) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
ehaerlpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkega
thsehralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrne
fvpykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvki
cdfglardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgas
pypgvkideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnll
qanaqqd

Sequence, based on observed residues (ATOM records): (download)

>d3be2a1 d.144.1.7 (A:815-1171) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
ehaerlpydaskwefprdrlklgkplgrgafgqvieadafgidtcrtvavkmlkegaths
ehralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvp
ykvapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdf
gplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmr
apdyttpemyqtmldcwhgepsqrptfselvehlgnllqanaqqd

SCOPe Domain Coordinates for d3be2a1:

Click to download the PDB-style file with coordinates for d3be2a1.
(The format of our PDB-style files is described here.)

Timeline for d3be2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3be2a2