SCOPe 2.03: Domain d3bdyv_: 3bdy V:

Lineage for d3bdyv_ (3bdy V:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (17 PDB entries)
   Uniprot P15692 40-133

8. Domain d3bdyv_: 3bdy V: [172568]
   Other proteins in same PDB: d3bdyl1, d3bdyl2
   automated match to d1katv_
   complexed with gol

Details for d3bdyv_

PDB Entry: 3bdy, 2.6 Å

PDB Description: dual specific bh1 fab in complex with vegf

PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d3bdyv_:

Sequence; same for both SEQRES and ATOM records:

>d3bdyv_ g.17.1.1 (V:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d3bdyv_:

• d3bdyv_ first appeared in SCOPe 2.01
  
• d3bdyv_ appears in SCOPe 2.02
  
• d3bdyv_ appears in SCOPe 2.04
  
• d3bdyv_ appears in the current release, SCOPe 2.08