SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3bdxc_ (3bdx C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (20 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (154 PDB entries)
  8. 2019805Domain d3bdxc_: 3bdx C: [172567]
    automated match to d1cd0a_
    complexed with act, gol, mes; mutant

Details for d3bdxc_

PDB Entry: 3bdx (more details), 2.3 Å

PDB Description: Crystal structure of the unstable and highly fibrillogenic Pro7Ser mutant of the Recombinant variable domain 6AJL2
PDB Compounds: (C:) Amyloid lambda 6 light chain variable region PIP (fragment)

SCOPe Domain Sequences for d3bdxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdxc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

SCOPe Domain Coordinates for d3bdxc_:

Click to download the PDB-style file with coordinates for d3bdxc_.
(The format of our PDB-style files is described here.)

Timeline for d3bdxc_: