Lineage for d3bdxc_ (3bdx C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742530Domain d3bdxc_: 3bdx C: [172567]
    automated match to d1cd0a_
    complexed with act, gol, mes; mutant

Details for d3bdxc_

PDB Entry: 3bdx (more details), 2.3 Å

PDB Description: crystal structure of the unstable and highly fibrillogenic pro7ser mutant of the recombinant variable domain 6ajl2
PDB Compounds: (C:) Amyloid lambda 6 light chain variable region PIP (fragment)

SCOPe Domain Sequences for d3bdxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bdxc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqshsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

SCOPe Domain Coordinates for d3bdxc_:

Click to download the PDB-style file with coordinates for d3bdxc_.
(The format of our PDB-style files is described here.)

Timeline for d3bdxc_: